Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CREM Peptide - C-terminal region

CREM Peptide - C-terminal region

Product Specifications

Product Name Alternative

CREM

UniProt

Q03060

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CREM Rabbit Polyclonal Antibody (orb331447) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LHSPQQLAEEATRKRELRLMKNREAAKECRRRKKEYVKCLESRVAVLEVQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human DEFb126 (Defensin Beta 126) ELISA Kit
ELK6682-01 48 Tests

Human DEFb126 (Defensin Beta 126) ELISA Kit

Sign In for Pricing
View Details
Human DEFb126 (Defensin Beta 126) ELISA Kit
ELK6682-02 96 Tests

Human DEFb126 (Defensin Beta 126) ELISA Kit

Sign In for Pricing
View Details
Human DEFb126 (Defensin Beta 126) ELISA Kit
ELK6682-03 5x 96 Tests

Human DEFb126 (Defensin Beta 126) ELISA Kit

Sign In for Pricing
View Details
GENLISA™ Human TNF related Activation induced cytokine (TRANCE) ELISA
KBH0390 1x 96 Well

GENLISA™ Human TNF related Activation induced cytokine (TRANCE) ELISA

Sign In for Pricing
View Details
HEATR7B1 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
23165154 3x 1.0 µg DNA

HEATR7B1 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
Human paramyxovirus parotitis IgG ELISA Kit
NSL2456Hu 96 Tests

Human paramyxovirus parotitis IgG ELISA Kit

Sign In for Pricing
View Details