Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DEDD Peptide - middle region

DEDD Peptide - middle region

Product Specifications

Product Name Alternative

DEDD, DEDPRO1, DEFT, KE05

UniProt

O75618

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DEDD Rabbit Polyclonal Antibody (orb331448) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_127491

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PTSGPQMCSKRPARGRATLGSQRKRRKSVTPDPKEKQTCDIRLRVRAEYC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRGPRX1 Protein Vector (Mouse) (pPB-N-His)
PV201935 500 ng

MRGPRX1 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Anti-Solo/SESTD1 Antibody Picoband® Fluoro594 Conjugated
A10698-1-Fluoro594 100 µg/Vial

Anti-Solo/SESTD1 Antibody Picoband® Fluoro594 Conjugated

Sign In for Pricing
View Details
Rat Lsr Pre-designed siRNA Set A
SI207897A 1 Each

Rat Lsr Pre-designed siRNA Set A

Sign In for Pricing
View Details
Pfn3 ORF Vector (Rat) (pORF)
ORF073392 1.0 µg DNA

Pfn3 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
INSM2 Protein Vector (Mouse) (pPM-C-HA)
PV191952 500 ng

INSM2 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
SAMSN1 Antibody
orb1315101-01 30 µL

SAMSN1 Antibody

Sign In for Pricing
View Details