Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DEDD Peptide - middle region

DEDD Peptide - middle region

Product Specifications

Product Name Alternative

DEDD, DEDPRO1, DEFT, KE05

UniProt

O75618

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DEDD Rabbit Polyclonal Antibody (orb331448) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_127491

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PTSGPQMCSKRPARGRATLGSQRKRRKSVTPDPKEKQTCDIRLRVRAEYC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

At1g10810 Antibody
orb784384 2 mg

At1g10810 Antibody

Sign In for Pricing
View Details
Benzyl Butyl Phthalate
RG-B051412-01 10 mg

Benzyl Butyl Phthalate

Sign In for Pricing
View Details
Benzyl Butyl Phthalate
RG-B051412-02 25 mg

Benzyl Butyl Phthalate

Sign In for Pricing
View Details
Benzyl Butyl Phthalate
RG-B051412-03 50 mg

Benzyl Butyl Phthalate

Sign In for Pricing
View Details
Benzyl Butyl Phthalate
RG-B051412-04 100 mg

Benzyl Butyl Phthalate

Sign In for Pricing
View Details
ZW10, NT (ZW10, Centromere/kinetochore protein zw10 homolog) (MaxLight 405) discontinued
044426-ML405 100 µL

ZW10, NT (ZW10, Centromere/kinetochore protein zw10 homolog) (MaxLight 405) discontinued

Sign In for Pricing
View Details