Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRCP Peptide - N-terminal region

PRCP Peptide - N-terminal region

Product Specifications

Product Name Alternative

PCP, HUMPCP

UniProt

P42785

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRCP Rabbit Polyclonal Antibody (orb327258) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VAEELKAMLVFAEHRYYGESLPFGDNSFKDSRHLNFLTSEQALADFAELI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pLV3-U6-GPX4-shRNA3-Puro Plasmid
PVT55809 2 µg

pLV3-U6-GPX4-shRNA3-Puro Plasmid

Sign In for Pricing
View Details
Vmn1r142 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K3085702 1.0 µg DNA

Vmn1r142 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
HSP-70 Antibody Blocking Peptide
orb1516196 500 µg

HSP-70 Antibody Blocking Peptide

Sign In for Pricing
View Details
STYXL1 (NM_016086) Human Untagged Clone
SC114445 10 µg

STYXL1 (NM_016086) Human Untagged Clone

Sign In for Pricing
View Details
Ghrl Mouse qPCR Primer Pair (NM_021488)
MP205441 200 Reactions

Ghrl Mouse qPCR Primer Pair (NM_021488)

Sign In for Pricing
View Details
AdmiRa-mmu-miR-135a-1-3p-Off Virus
mm5110 1.0 mL

AdmiRa-mmu-miR-135a-1-3p-Off Virus

Sign In for Pricing
View Details