Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ERCC8 Peptide - C-terminal region

ERCC8 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ERCC8, CKN1, CSA

UniProt

Q13216

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ERCC8 Rabbit Polyclonal Antibody (orb588260) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TVGTDNRMRLWNSSNGENTLVNYGKVCNNSKKGLKFTVSCGCSSEFVFVP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Arachidonoyl Chloride
TRC-A765155-5MG 5 mg

Arachidonoyl Chloride

Sign In for Pricing
View Details
Human TNF Receptor II Recombinant Rabbit monoclonal Antibody
HA723402 100 µL

Human TNF Receptor II Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
AMPA-15N (>90%)
TRC-A246210-5MG 5 mg

AMPA-15N (>90%)

Sign In for Pricing
View Details
GRK5 Human Gene Knockout Kit (CRISPR)
KN209137BN 1 Kit

GRK5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human C12orf74 activation kit by CRISPRa
GA117392 1 Kit

Human C12orf74 activation kit by CRISPRa

Sign In for Pricing
View Details
FITC Anti-Mouse TER-119 Antibody[TER-119]
E-AB-F1125C-01 50 Tests

FITC Anti-Mouse TER-119 Antibody[TER-119]

Sign In for Pricing
View Details