Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ITIH1 Peptide - C-terminal region

ITIH1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ITIH1, IGHEP1

UniProt

P19827

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ITIH1 Rabbit Polyclonal Antibody (orb588286) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QPSPTHSSSNTQRLPDRVTGVDTDPHFIIHVPQKEDTLCFNINEEPGVIL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human IL4RA/CD124 Protein (His Tag)
PKSH031630 100 µg

Recombinant Human IL4RA/CD124 Protein (His Tag)

Sign In for Pricing
View Details
p18 INK4c (CDKN2C) (NM_001262) Human Over-expression Lysate
LC420041 20 µg

p18 INK4c (CDKN2C) (NM_001262) Human Over-expression Lysate

Sign In for Pricing
View Details
MyBath™ 2L Digital Water Bath, 115V
B2000-2 1 Each

MyBath™ 2L Digital Water Bath, 115V

Sign In for Pricing
View Details
Basic Water Purification System BBPS-501
BBPS-501 1 Unit

Basic Water Purification System BBPS-501

Sign In for Pricing
View Details
EMC10 Rabbit Polyclonal Antibody
ER1706-95 100 µL

EMC10 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
General Purpose Incubator BIGP-6505
BIGP-6505 1 Unit

General Purpose Incubator BIGP-6505

Sign In for Pricing
View Details