ITIH1 Peptide - C-terminal region
ITIH1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
ITIH1, IGHEP1
UniProt
P19827
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ITIH1 Rabbit Polyclonal Antibody (orb588286) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: QPSPTHSSSNTQRLPDRVTGVDTDPHFIIHVPQKEDTLCFNINEEPGVIL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC042122-500 1x 500 µL
Ubiquitin (Autophagy Marker) (UBB/2122), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNUM1952-50 1x 50 µL
CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/1952), 1mg/mL
Sign In for Pricing
View Details 
LC426557 20 µg
Pit1 (POU1F1) (NM_001122757) Human Over-expression Lysate
Sign In for Pricing
View Details 
