MAP4 Peptide - N-terminal region
MAP4 Peptide - N-terminal region
Product Specifications
Product Name Alternative
MAP4
UniProt
P27816
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MAP4 Rabbit Polyclonal Antibody (orb588298) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GHGVEGSDTTGSPTEFLEEKMAYQEYPNSQNWPEDTNFCFQPEQVVDPIQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LY433943 100 µg
Small leucine rich protein 1 (SmLR1) (NM_001195597) Human Over-expression Lysate
Sign In for Pricing
View Details 
BNC681934-100 1x 100 µL
HSV1 (Herpes Simplex Virus Type I) (HSV1/1934), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details