Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAP4 Peptide - N-terminal region

MAP4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MAP4

UniProt

P27816

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MAP4 Rabbit Polyclonal Antibody (orb588298) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GHGVEGSDTTGSPTEFLEEKMAYQEYPNSQNWPEDTNFCFQPEQVVDPIQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Carpipramine Dihydrochloride
TRC-C184320-1MG 1 mg

Carpipramine Dihydrochloride

Sign In for Pricing
View Details
Recombinant Human Chitotriosidase/CHIT1 Protein (His Tag)
PKSH032245-01 10 µg

Recombinant Human Chitotriosidase/CHIT1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human Chitotriosidase/CHIT1 Protein (His Tag)
PKSH032245-02 50 µg

Recombinant Human Chitotriosidase/CHIT1 Protein (His Tag)

Sign In for Pricing
View Details
ADCY5 Human Gene Knockout Kit (CRISPR)
KN222906LP 1 Kit

ADCY5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Di(2-(4-(dibenzo[b,f][1,4]thiazepin-11-yl)piperazin-1-yl))-2-propoxyethyl Propionate
TRC-D417110-10MG 10 mg

Di(2-(4-(dibenzo[b,f][1,4]thiazepin-11-yl)piperazin-1-yl))-2-propoxyethyl Propionate

Sign In for Pricing
View Details
RASGRP2 (NM_001098670) Human Recombinant Protein
TP312672 20 µg

RASGRP2 (NM_001098670) Human Recombinant Protein

Sign In for Pricing
View Details