Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCF7L1 Peptide - C-terminal region

TCF7L1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

TCF3, TCF-3

UniProt

Q9HCS4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TCF7L1 Rabbit Polyclonal Antibody (orb324361) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_112573

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LHSQLYPTWSARDNYGKKKKRKREKQLSQTQSQQQVQEAEGALASKSKKP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRPL39 Human qPCR Primer Pair (NM_080794)
HP227407 200 Reactions

MRPL39 Human qPCR Primer Pair (NM_080794)

Sign In for Pricing
View Details
Tissue FFPE Sections, Endometrium
CS709090 5x 5 µm

Tissue FFPE Sections, Endometrium

Sign In for Pricing
View Details
4-Bromo-2-chlorobenzoic Acid
TRC-B682115-5G 5 g

4-Bromo-2-chlorobenzoic Acid

Sign In for Pricing
View Details
SCF (KITLG) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6E5]
TA507211AM 100 µL

SCF (KITLG) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6E5]

Sign In for Pricing
View Details
UAP56 (DDX39B) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E4]
TA501235AM 100 µL

UAP56 (DDX39B) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E4]

Sign In for Pricing
View Details
Zeaxanthin Monopalmitate
TRC-Z297550-50MG 50 mg

Zeaxanthin Monopalmitate

Sign In for Pricing
View Details