Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCF7L1 Peptide - C-terminal region

TCF7L1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

TCF3, TCF-3

UniProt

Q9HCS4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TCF7L1 Rabbit Polyclonal Antibody (orb324361) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_112573

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LHSQLYPTWSARDNYGKKKKRKREKQLSQTQSQQQVQEAEGALASKSKKP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TMEM220 activation kit by CRISPRa
GA117945 1 Kit

Human TMEM220 activation kit by CRISPRa

Sign In for Pricing
View Details
Histone H1 (Nuclear Marker) (HH1/1784R), CF568 conjugate, 0.1mg/mL
BNC681784-100 1x 100 µL

Histone H1 (Nuclear Marker) (HH1/1784R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
6-Amino-1,3-dipropyl-5-nitrosouracil
TRC-A608000-250MG 250 mg

6-Amino-1,3-dipropyl-5-nitrosouracil

Sign In for Pricing
View Details
HRP Conjugated Vigna radiata Lectin (Mung Bean) -VRA-
H-6501-1 1 mg

HRP Conjugated Vigna radiata Lectin (Mung Bean) -VRA-

Sign In for Pricing
View Details
DDX23 Human Gene Knockout Kit (CRISPR)
KN401758 1 Kit

DDX23 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RELB Antibody
OC-411-01 50 μL

RELB Antibody

Sign In for Pricing
View Details