Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NR6A1 Peptide - middle region

NR6A1 Peptide - middle region

Product Specifications

Product Name Alternative

NR6A1, GCNF

UniProt

Q15406

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NR6A1 Rabbit Polyclonal Antibody (orb573936) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GGRNKSIGPVQISEEEIERIMSGQEFEEEANHWSNHGDSDHSSPGNRASE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rac 1-heptandecanoyl-3-chloropropanediol
288627-01 10 mg

Rac 1-heptandecanoyl-3-chloropropanediol

Sign In for Pricing
View Details
Rac 1-heptandecanoyl-3-chloropropanediol
288627-02 25 mg

Rac 1-heptandecanoyl-3-chloropropanediol

Sign In for Pricing
View Details
Rac 1-heptandecanoyl-3-chloropropanediol
288627-03 50 mg

Rac 1-heptandecanoyl-3-chloropropanediol

Sign In for Pricing
View Details
Rac 1-heptandecanoyl-3-chloropropanediol
288627-04 100 mg

Rac 1-heptandecanoyl-3-chloropropanediol

Sign In for Pricing
View Details
Rac 1-heptandecanoyl-3-chloropropanediol
288627-05 250 mg

Rac 1-heptandecanoyl-3-chloropropanediol

Sign In for Pricing
View Details
Rabbit anti-Cytochrome P450 2C9 Antibody
YLD2345-01 50 µL

Rabbit anti-Cytochrome P450 2C9 Antibody

Sign In for Pricing
View Details