NR6A1 Peptide - middle region
NR6A1 Peptide - middle region
Product Specifications
Product Name Alternative
NR6A1, GCNF
UniProt
Q15406
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with NR6A1 Rabbit Polyclonal Antibody (orb573936) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GGRNKSIGPVQISEEEIERIMSGQEFEEEANHWSNHGDSDHSSPGNRASE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6123402-01 0.1 mL
Lambda Light Chain (Bence Jones Protein, BJP, IGLC 1/2/3, Mcg Marker, Paraprotein) (AP)
Sign In for Pricing
View Details MBS6123402-02 5x 0.1 mL
Lambda Light Chain (Bence Jones Protein, BJP, IGLC 1/2/3, Mcg Marker, Paraprotein) (AP)
Sign In for Pricing
View Details 
LV627836 1.0 µg DNA
Olr1633 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
Sign In for Pricing
View Details 
AMM10230V 100 µL
B7-1 (CD80) Mouse Monoclonal Antibody [Clone ID: LBI7E4]
Sign In for Pricing
View Details abx336657-01 20 µg
Myotonin-Protein Kinase (DMPK) Antibody (Biotin)
Sign In for Pricing
View Details