Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RASSF8 Peptide - N-terminal region

RASSF8 Peptide - N-terminal region

Product Specifications

Product Name Alternative

HOJ1, C12orf2

UniProt

Q8NHQ8

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RASSF8 Rabbit Polyclonal Antibody (orb325730) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RHLAPHENPIISLNKWGQYASDVQLILRRTGPSLSERPTSDSVARIPERT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Putative golgin subfamily A member 2B, GOLGA2L1 ELISA Kit
MBS9326329-01 48 Well

Human Putative golgin subfamily A member 2B, GOLGA2L1 ELISA Kit

Sign In for Pricing
View Details
Human Putative golgin subfamily A member 2B, GOLGA2L1 ELISA Kit
MBS9326329-02 96 Well

Human Putative golgin subfamily A member 2B, GOLGA2L1 ELISA Kit

Sign In for Pricing
View Details
Human Putative golgin subfamily A member 2B, GOLGA2L1 ELISA Kit
MBS9326329-03 5x 96 Well

Human Putative golgin subfamily A member 2B, GOLGA2L1 ELISA Kit

Sign In for Pricing
View Details
Human Putative golgin subfamily A member 2B, GOLGA2L1 ELISA Kit
MBS9326329-04 10x 96 Well

Human Putative golgin subfamily A member 2B, GOLGA2L1 ELISA Kit

Sign In for Pricing
View Details
Recombinant Gamma Actin (ACTG)
SIPB759Hu01-01 10 µg

Recombinant Gamma Actin (ACTG)

Sign In for Pricing
View Details
Recombinant Gamma Actin (ACTG)
SIPB759Hu01-02 50 µg

Recombinant Gamma Actin (ACTG)

Sign In for Pricing
View Details