Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RASSF8 Peptide - N-terminal region

RASSF8 Peptide - N-terminal region

Product Specifications

Product Name Alternative

HOJ1, C12orf2

UniProt

Q8NHQ8

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RASSF8 Rabbit Polyclonal Antibody (orb325730) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RHLAPHENPIISLNKWGQYASDVQLILRRTGPSLSERPTSDSVARIPERT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Clcnkb Mouse shRNA Plasmid (Locus ID 56365)
TR503163 1 Kit

Clcnkb Mouse shRNA Plasmid (Locus ID 56365)

Sign In for Pricing
View Details
2-Ethylhexan-1-ol
orb3023606-01 500 mg

2-Ethylhexan-1-ol

Sign In for Pricing
View Details
2-Ethylhexan-1-ol
orb3023606-02 1 g

2-Ethylhexan-1-ol

Sign In for Pricing
View Details
GATA3 Recombinant Rabbit mAb, BF680 conjugated
orb2331978 100 µL

GATA3 Recombinant Rabbit mAb, BF680 conjugated

Sign In for Pricing
View Details
HEY1 Protein Vector (Human) (pPM-C-HA)
23227021 500 ng

HEY1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Phosphatidylinositol (BSA - Conjugated)
OOCD00347-10UG 10 µg

Phosphatidylinositol (BSA - Conjugated)

Sign In for Pricing
View Details