Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ISY1 Peptide - C-terminal region

ISY1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ISY1, KIAA1160

UniProt

Q9ULR0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ISY1 Rabbit Polyclonal Antibody (orb326238) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EKGGDDSQQKFIAHVPVPSQQEIEEALVRRKKMELLQKYASETLQAQSEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Tnfaip2 Pre-designed siRNA Set A
SI214934A 1 Each

Rat Tnfaip2 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Bromo-PEG5-bromide
orb1909447-01 100 mg

Bromo-PEG5-bromide

Sign In for Pricing
View Details
Bromo-PEG5-bromide
orb1909447-02 500 mg

Bromo-PEG5-bromide

Sign In for Pricing
View Details
SLMAP Human Gene Knockout Kit (CRISPR)
KN421364 1 Kit

SLMAP Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Lipin 3 Rabbit Polyclonal Antibody (BF405)
orb2481662 100 µL

Lipin 3 Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details
VASA (2F9H5) Alexa Fluor® 680
sc-517247 AF680 200 µg/mL

VASA (2F9H5) Alexa Fluor® 680

Sign In for Pricing
View Details