Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ISY1 Peptide - C-terminal region

ISY1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ISY1, KIAA1160

UniProt

Q9ULR0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ISY1 Rabbit Polyclonal Antibody (orb326238) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EKGGDDSQQKFIAHVPVPSQQEIEEALVRRKKMELLQKYASETLQAQSEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hnrnpa2b1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
23733114 3x 1.0 µg

Hnrnpa2b1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
GTPBP3 Protein Lysate
OCOA21423-20UG 20 µg

GTPBP3 Protein Lysate

Sign In for Pricing
View Details
TTF1 (Transcription Termination Factor 1, TTF-1, RNA Polymerase I Termination Factor, Transcription Termination Factor I, TTF-I) discontinued
346371-01 100 µL

TTF1 (Transcription Termination Factor 1, TTF-1, RNA Polymerase I Termination Factor, Transcription Termination Factor I, TTF-I) discontinued

Sign In for Pricing
View Details
TTF1 (Transcription Termination Factor 1, TTF-1, RNA Polymerase I Termination Factor, Transcription Termination Factor I, TTF-I) discontinued
346371-02 200 µL

TTF1 (Transcription Termination Factor 1, TTF-1, RNA Polymerase I Termination Factor, Transcription Termination Factor I, TTF-I) discontinued

Sign In for Pricing
View Details
Anti-TCR betaF1 [38C2]
orb1906346 0.2 mg

Anti-TCR betaF1 [38C2]

Sign In for Pricing
View Details
Recombinant Interleukin 13 (IL13)
TRV-0006885-01 10 µg

Recombinant Interleukin 13 (IL13)

Sign In for Pricing
View Details