Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALPI Peptide - C-terminal region

ALPI Peptide - C-terminal region

Product Specifications

Product Name Alternative

IAP

UniProt

P09923

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ALPI Rabbit Polyclonal Antibody (orb326474) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001622

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LAPSKAQDSKAYTSILYGNGPGYVFNSGVRPDVNESESGSPDYQQQAAVP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Borrelia Garinii dnaJ Protein (aa 1-364)
VAng-Lsx2057-1mgEcoli 1 mg (E. coli)

Recombinant Borrelia Garinii dnaJ Protein (aa 1-364)

Sign In for Pricing
View Details
Human C5b-9 (Terminal Complement Complex C5b-9) ELISA Kit
MBS8802026-01 48 Strip Well

Human C5b-9 (Terminal Complement Complex C5b-9) ELISA Kit

Sign In for Pricing
View Details
Human C5b-9 (Terminal Complement Complex C5b-9) ELISA Kit
MBS8802026-02 96 Strip Well

Human C5b-9 (Terminal Complement Complex C5b-9) ELISA Kit

Sign In for Pricing
View Details
Human C5b-9 (Terminal Complement Complex C5b-9) ELISA Kit
MBS8802026-03 5x 96 Strip Well

Human C5b-9 (Terminal Complement Complex C5b-9) ELISA Kit

Sign In for Pricing
View Details
Human C5b-9 (Terminal Complement Complex C5b-9) ELISA Kit
MBS8802026-04 10x 96 Strip Well

Human C5b-9 (Terminal Complement Complex C5b-9) ELISA Kit

Sign In for Pricing
View Details
C2orf14 CRISPR All-in-one AAV vector set (with saCas9)(Human)
53765151 3x 1.0 µg DNA

C2orf14 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details