Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARHGAP26 Peptide - middle region

ARHGAP26 Peptide - middle region

Product Specifications

Product Name Alternative

GRAF, GRAF1, OPHN1L, OPHN1L1

UniProt

Q9UNA1

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ARHGAP26 Rabbit Polyclonal Antibody (orb327230) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055886

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LWMEAMDGREPVYNSNKDSQSEGTAQLDSIGFSIIRKCIHAVETRGINEQ

More Discoveries

Explore Other Products

Browse additional items from our catalog

CEP250 Antibody
A68064-100UG 100 µg

CEP250 Antibody

Sign In for Pricing
View Details
Atxn3 (NM_029705) Mouse Untagged Clone
MC212229 10 µg

Atxn3 (NM_029705) Mouse Untagged Clone

Sign In for Pricing
View Details
Neurokinin A Receptor Antibody, PE Conjugated
bs-0123R-PE 100 µL

Neurokinin A Receptor Antibody, PE Conjugated

Sign In for Pricing
View Details
PITPNB (Phosphatidylinositol Transfer Protein beta Isoform, PI-TP-beta, PtdIns Transfer Protein beta, PtdInsTP beta) (AP)
MBS6132972-01 0.1 mL

PITPNB (Phosphatidylinositol Transfer Protein beta Isoform, PI-TP-beta, PtdIns Transfer Protein beta, PtdInsTP beta) (AP)

Sign In for Pricing
View Details
PITPNB (Phosphatidylinositol Transfer Protein beta Isoform, PI-TP-beta, PtdIns Transfer Protein beta, PtdInsTP beta) (AP)
MBS6132972-02 5x 0.1 mL

PITPNB (Phosphatidylinositol Transfer Protein beta Isoform, PI-TP-beta, PtdIns Transfer Protein beta, PtdInsTP beta) (AP)

Sign In for Pricing
View Details
Rabbit anti-human Myelin expression factor 2 polyclonal Antibody, HRP conjugated
MBS1492294-01 0.05 mg

Rabbit anti-human Myelin expression factor 2 polyclonal Antibody, HRP conjugated

Sign In for Pricing
View Details