Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARHGAP26 Peptide - middle region

ARHGAP26 Peptide - middle region

Product Specifications

Product Name Alternative

GRAF, GRAF1, OPHN1L, OPHN1L1

UniProt

Q9UNA1

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ARHGAP26 Rabbit Polyclonal Antibody (orb327230) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055886

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LWMEAMDGREPVYNSNKDSQSEGTAQLDSIGFSIIRKCIHAVETRGINEQ

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse E3 ubiquitin-protein ligase MARCH5 (MARCH5)
MBS7006882-01 0.02 mg (E-Coli)

Recombinant Mouse E3 ubiquitin-protein ligase MARCH5 (MARCH5)

Sign In for Pricing
View Details
Recombinant Mouse E3 ubiquitin-protein ligase MARCH5 (MARCH5)
MBS7006882-02 0.1 mg (E-Coli)

Recombinant Mouse E3 ubiquitin-protein ligase MARCH5 (MARCH5)

Sign In for Pricing
View Details
Recombinant Mouse E3 ubiquitin-protein ligase MARCH5 (MARCH5)
MBS7006882-03 5x 0.1 mg (E-Coli)

Recombinant Mouse E3 ubiquitin-protein ligase MARCH5 (MARCH5)

Sign In for Pricing
View Details
Lentiviral human PCDHB13 shRNA (UAS) - Lentiviral human PCDHB13 shRNA (UAS, GFP) (25)
GTR15310787 1 Vial

Lentiviral human PCDHB13 shRNA (UAS) - Lentiviral human PCDHB13 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Streptavidin Poly-HRP40 Conjugate
65R-S113 50 ug

Streptavidin Poly-HRP40 Conjugate

Sign In for Pricing
View Details
Rab 18 rabbit pAb
ES5274-01 50 µL

Rab 18 rabbit pAb

Sign In for Pricing
View Details