Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARL4C Peptide - N-terminal region

ARL4C Peptide - N-terminal region

Product Specifications

Product Name Alternative

ARL4C, ARL7

UniProt

P56559

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ARL4C Rabbit Polyclonal Antibody (orb588110) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005728

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LGLDSAGKTTVLYRLKFNEFVNTVPTIGFNTEKIKLSNGTAKGISCHFWD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

JIP-4 CRISPR Activation Plasmid (h)
sc-417514-ACT 20 µg

JIP-4 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
PBX1 Protein Lysate (Human) with C-Ha Tag
36078031 100 µg

PBX1 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Genorise® Biotinylated Ferret CCL2 Polyclonal Antibody
GR214038 50 µg

Genorise® Biotinylated Ferret CCL2 Polyclonal Antibody

Sign In for Pricing
View Details
Fructose 6 Phosphate Kinase (PFKM) Antibody (C-term)
orb1928573-01 50 µL

Fructose 6 Phosphate Kinase (PFKM) Antibody (C-term)

Sign In for Pricing
View Details
Fructose 6 Phosphate Kinase (PFKM) Antibody (C-term)
orb1928573-02 100 µL

Fructose 6 Phosphate Kinase (PFKM) Antibody (C-term)

Sign In for Pricing
View Details
F2 Blocking peptide
orb1443435 500 µg

F2 Blocking peptide

Sign In for Pricing
View Details