Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARL4C Peptide - N-terminal region

ARL4C Peptide - N-terminal region

Product Specifications

Product Name Alternative

ARL4C, ARL7

UniProt

P56559

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ARL4C Rabbit Polyclonal Antibody (orb588110) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005728

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LGLDSAGKTTVLYRLKFNEFVNTVPTIGFNTEKIKLSNGTAKGISCHFWD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TBA354
B5935-5.1 10 mM (in 1mL DMSO)

TBA354

Sign In for Pricing
View Details
BCL11B Rabbit Polyclonal Antibody (HRP)
orb2588217 100 µg

BCL11B Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Hsa-miR-548ar-5p miRNA Antagomir
orb1914519-01 10 nmol

Hsa-miR-548ar-5p miRNA Antagomir

Sign In for Pricing
View Details
Hsa-miR-548ar-5p miRNA Antagomir
orb1914519-02 20 nmol

Hsa-miR-548ar-5p miRNA Antagomir

Sign In for Pricing
View Details
CD279 (CT) (Programmed cell death-1, PD-1) (APC)
P3120-62D-APC 100 µL

CD279 (CT) (Programmed cell death-1, PD-1) (APC)

Sign In for Pricing
View Details
Vanillyl Butyl Ether
OR1015414-01 5 g

Vanillyl Butyl Ether

Sign In for Pricing
View Details