Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF5A Peptide - C-terminal region

EIF5A Peptide - C-terminal region

Product Specifications

Product Name Alternative

EIF-5A, EIF5A1, eIF5AI

UniProt

P63241

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EIF5A Rabbit Polyclonal Antibody (orb327237) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLQDSGEVREDLRLPEGDLGKEIEQKYDCGEEILITVLSAMTEEAAVAIK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Saccharum hybrid Cytochrome b6-f complex subunit 8 (petN), partial
MBS7089043 Inquire

Recombinant Saccharum hybrid Cytochrome b6-f complex subunit 8 (petN), partial

Sign In for Pricing
View Details
MGRN1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV681007 1.0 µg DNA

MGRN1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
TrkB Polyclonal Antibody
MBS8578681-01 0.1 mL

TrkB Polyclonal Antibody

Sign In for Pricing
View Details
TrkB Polyclonal Antibody
MBS8578681-02 0.1 mL (AF405L)

TrkB Polyclonal Antibody

Sign In for Pricing
View Details
TrkB Polyclonal Antibody
MBS8578681-03 0.1 mL (AF405S)

TrkB Polyclonal Antibody

Sign In for Pricing
View Details
TrkB Polyclonal Antibody
MBS8578681-04 0.1 mL (AF610)

TrkB Polyclonal Antibody

Sign In for Pricing
View Details