Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM162A Peptide - N-terminal region

FAM162A Peptide - N-terminal region

Product Specifications

Product Name Alternative

E2IG5, HGTD-P, C3orf28

UniProt

Q96A26

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FAM162A Rabbit Polyclonal Antibody (orb588113) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055182

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SLRLTRSSDLKRINGFCTKPQESPGAPSRTYNRVPLHKPTDWQKKILIWS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (CRIS-7), CF488A conjugate, 0.1mg/mL
BNC881050-500 1x 500 µL

CD3e (CRIS-7), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF543 conjugate, 0.1mg/mL
BNC430151-500 1x 500 µL

CD11a (Cris-3), CF543 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF568 conjugate, 0.1mg/mL
BNC680146-100 1x 100 µL

CD10 (CB-CALLA), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), 1mg/mL
BNUM0871-50 1x 50 µL

CD71 (66IG10), 1mg/mL

Sign In for Pricing
View Details
Adipophilin / Perilipin-2 (Marker of Obesity) (ADFP/1366), CF740 conjugate, 0.1mg/mL
BNC741366-100 1x 100 µL

Adipophilin / Perilipin-2 (Marker of Obesity) (ADFP/1366), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Myosin, Smooth Muscle Heavy Chain (SMMS-1), CF568 conjugate, 0.1mg/mL
BNC680893-500 1x 500 µL

Myosin, Smooth Muscle Heavy Chain (SMMS-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details