HMG20B Peptide - middle region
HMG20B Peptide - middle region
Product Specifications
Product Name Alternative
SOXL, HMGX2, BRAF25, BRAF35, HMGXB2, PP7706, pp8857, SMARCE1r
UniProt
Q9P0W2
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with HMG20B Rabbit Polyclonal Antibody (orb327240) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_006330
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SEAYKMCTEKIQEKKIKKEDSSSGLMNTLLNGHKGGDCDGFSTFDVPIFT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNCB2350-500 1x 500 µL
GPN1 / XAB1 (DNA Repair & Protein Synthesis) (GPN1/2350), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
GTR15086862 1 Vial
Lentiviral human FNDC9 shRNA (UAS) - Lentiviral human FNDC9 shRNA (UAS) (100)
Sign In for Pricing
View Details