Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HMG20B Peptide - middle region

HMG20B Peptide - middle region

Product Specifications

Product Name Alternative

SOXL, HMGX2, BRAF25, BRAF35, HMGXB2, PP7706, pp8857, SMARCE1r

UniProt

Q9P0W2

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HMG20B Rabbit Polyclonal Antibody (orb327240) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006330

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SEAYKMCTEKIQEKKIKKEDSSSGLMNTLLNGHKGGDCDGFSTFDVPIFT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCTD1 Antibody, Biotin conjugated
A58354-100UG 100 µg

KCTD1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Mouse CBX3 (Chromobox Homolog 3) ELISA Kit
RE1407M-01 48 Tests

Mouse CBX3 (Chromobox Homolog 3) ELISA Kit

Sign In for Pricing
View Details
Mouse CBX3 (Chromobox Homolog 3) ELISA Kit
RE1407M-02 96 Tests

Mouse CBX3 (Chromobox Homolog 3) ELISA Kit

Sign In for Pricing
View Details
Porcine COL6α3 (Collagen Type VI Alpha 3) ValidElisa Kit
EK344394 96 Well

Porcine COL6α3 (Collagen Type VI Alpha 3) ValidElisa Kit

Sign In for Pricing
View Details
GLDC siRNA (h)
sc-92873 10 µM

GLDC siRNA (h)

Sign In for Pricing
View Details
Lentiviral mouse Tcap shRNA (UAS) - Lentiviral mouse Tcap shRNA (UAS, RFP) (25)
GTR15109667 1 Vial

Lentiviral mouse Tcap shRNA (UAS) - Lentiviral mouse Tcap shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details