HMGCR Peptide - C-terminal region
HMGCR Peptide - C-terminal region
Product Specifications
Product Name Alternative
HMGCR
UniProt
P04035
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with HMGCR Rabbit Polyclonal Antibody (orb327241) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LSKKLSEPSSLQYLPYRDYNYSLVMGACCENVIGYMPIPVGVAGPLCLDE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6223029-01 0.1 mL
LRIG3 (Leucine-rich Repeats and Immunoglobulin-like Domains Protein 3, LIG-3, LIG3, UNQ287/PRO326/PRO335, LIG3) (MaxLight 650)
Sign In for Pricing
View Details MBS6223029-02 5x 0.1 mL
LRIG3 (Leucine-rich Repeats and Immunoglobulin-like Domains Protein 3, LIG-3, LIG3, UNQ287/PRO326/PRO335, LIG3) (MaxLight 650)
Sign In for Pricing
View Details 