Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFIT1 Peptide - C-terminal region

IFIT1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

IFIT1, G10P1, IFI56, IFNAI1, ISG56

UniProt

P09914

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IFIT1 Rabbit Polyclonal Antibody (orb588125) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001539

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KGQPRGQNREKLDKMIRSAIFHFESAVEKKPTFEVAHLDLARMYIEAGNH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Tubulin alpha antibody
STJ96796 200 µl

Anti-Tubulin alpha antibody

Sign In for Pricing
View Details
EHD1 - (Peptide)
CRB1001212-01 0.5 mg

EHD1 - (Peptide)

Sign In for Pricing
View Details
EHD1 - (Peptide)
CRB1001212-02 1 mg

EHD1 - (Peptide)

Sign In for Pricing
View Details
Anti-GATA3 (Rabbit, Monoclonal)
A103979 100 µL

Anti-GATA3 (Rabbit, Monoclonal)

Sign In for Pricing
View Details
Polyclonal Antibody to Immunoglobulin E (IgE)
TRV-0016209-01 20 µL

Polyclonal Antibody to Immunoglobulin E (IgE)

Sign In for Pricing
View Details
Polyclonal Antibody to Immunoglobulin E (IgE)
TRV-0016209-02 100 µL

Polyclonal Antibody to Immunoglobulin E (IgE)

Sign In for Pricing
View Details