Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFIT1 Peptide - C-terminal region

IFIT1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

IFIT1, G10P1, IFI56, IFNAI1, ISG56

UniProt

P09914

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IFIT1 Rabbit Polyclonal Antibody (orb588125) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001539

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KGQPRGQNREKLDKMIRSAIFHFESAVEKKPTFEVAHLDLARMYIEAGNH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Furfuryl isocyanate
sc-235229 1 g

Furfuryl isocyanate

Sign In for Pricing
View Details
CRTAP (Cartilage Associated Protein, OI7, CASP, LEPREL3) (PE)
MBS6412536-01 0.1 mL

CRTAP (Cartilage Associated Protein, OI7, CASP, LEPREL3) (PE)

Sign In for Pricing
View Details
CRTAP (Cartilage Associated Protein, OI7, CASP, LEPREL3) (PE)
MBS6412536-02 5x 0.1 mL

CRTAP (Cartilage Associated Protein, OI7, CASP, LEPREL3) (PE)

Sign In for Pricing
View Details
Garcinexanthone A
MBS5762441 Inquire

Garcinexanthone A

Sign In for Pricing
View Details
EPX shRNA (m) Lentiviral Particles
sc-60015-V 200 µL

EPX shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
Slc31a1 (NM_175090) Mouse Tagged ORF Clone Lentiviral Particle
MR201919L4V 200 µL

Slc31a1 (NM_175090) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details