Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL3RA Peptide - C-terminal region

IL3RA Peptide - C-terminal region

Product Specifications

Product Name Alternative

IL3RA, IL3R

UniProt

P26951

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IL3RA Rabbit Polyclonal Antibody (orb588127) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005274837

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CRRYLVMQRLFPRIPHMKDPIGDSFQNDKLVVWEAGKAGLEECLVTEVQV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal CTLA-4 Antibody (rCTLA4/7219) [Alexa Fluor 532]
NBP3-20809AF532 0.1 mL

Mouse Monoclonal CTLA-4 Antibody (rCTLA4/7219) [Alexa Fluor 532]

Sign In for Pricing
View Details
DTX1 Rabbit pAb
E45R29059N-100 100 µL

DTX1 Rabbit pAb

Sign In for Pricing
View Details
GM CSF (CSF2) (NM_000758) Human Recombinant Protein
TP721106L 500 µg

GM CSF (CSF2) (NM_000758) Human Recombinant Protein

Sign In for Pricing
View Details
NatureTip 20μL Filtered Pipet Tip (B)
BHZ08B1WB-FS 20 µL

NatureTip 20μL Filtered Pipet Tip (B)

Sign In for Pricing
View Details
3,4,6-Tri-O-acetyl-2-deoxy-2-fluoro-β-D-glucopyranosyl fluoride
GC5681-100mg 100 mg

3,4,6-Tri-O-acetyl-2-deoxy-2-fluoro-β-D-glucopyranosyl fluoride

Sign In for Pricing
View Details
Extracellular serine protease Antibody
orb824497 2 mg

Extracellular serine protease Antibody

Sign In for Pricing
View Details