Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL3RA Peptide - C-terminal region

IL3RA Peptide - C-terminal region

Product Specifications

Product Name Alternative

IL3RA, IL3R

UniProt

P26951

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IL3RA Rabbit Polyclonal Antibody (orb588127) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005274837

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CRRYLVMQRLFPRIPHMKDPIGDSFQNDKLVVWEAGKAGLEECLVTEVQV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1- (Hydroxymethyl) -3,3-dimethylcyclohexan-1-ol
WLC78044-01 100 mg

1- (Hydroxymethyl) -3,3-dimethylcyclohexan-1-ol

Sign In for Pricing
View Details
1- (Hydroxymethyl) -3,3-dimethylcyclohexan-1-ol
WLC78044-02 1 g

1- (Hydroxymethyl) -3,3-dimethylcyclohexan-1-ol

Sign In for Pricing
View Details
Nip7 Mouse shRNA Lentiviral Particle (Locus ID 66164)
TL512551V 500 µL Each

Nip7 Mouse shRNA Lentiviral Particle (Locus ID 66164)

Sign In for Pricing
View Details
CAP - 18, rabbit
M42029-01 100 mg

CAP - 18, rabbit

Sign In for Pricing
View Details
CAP - 18, rabbit
M42029-02 25 mg

CAP - 18, rabbit

Sign In for Pricing
View Details
CAP - 18, rabbit
M42029-03 50 mg

CAP - 18, rabbit

Sign In for Pricing
View Details