Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ITIH4 Peptide - C-terminal region

ITIH4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ITIH4, IHRP, ITIHL1, PK120, PRO1851

UniProt

Q14624

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ITIH4 Rabbit Polyclonal Antibody (orb333852) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002209

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QEVLWGSPAASDDGRRTLRVQGNDHSATRERRLDYQEGPPGVEISCWSVE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC Anti-Human CD195/CCR5 Antibody[HEK/1/85a]
E-AB-F1392E-01 20 Tests

APC Anti-Human CD195/CCR5 Antibody[HEK/1/85a]

Sign In for Pricing
View Details
APC Anti-Human CD195/CCR5 Antibody[HEK/1/85a]
E-AB-F1392E-02 100 Tests

APC Anti-Human CD195/CCR5 Antibody[HEK/1/85a]

Sign In for Pricing
View Details
APC Anti-Human CD195/CCR5 Antibody[HEK/1/85a]
E-AB-F1392E-03 2x 100 Tests

APC Anti-Human CD195/CCR5 Antibody[HEK/1/85a]

Sign In for Pricing
View Details
Vmn2r14 Mouse Gene Knockout Kit (CRISPR)
KN519140 1 Kit

Vmn2r14 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
C10orf131 (NM_001130446) Human Over-expression Lysate
LC427212 20 µg

C10orf131 (NM_001130446) Human Over-expression Lysate

Sign In for Pricing
View Details
7-Hydroxy Coumarin-d5 Sulfate Potassium Salt
TRC-H924893-25MG 25 mg

7-Hydroxy Coumarin-d5 Sulfate Potassium Salt

Sign In for Pricing
View Details