Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ITIH4 Peptide - C-terminal region

ITIH4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ITIH4, IHRP, ITIHL1, PK120, PRO1851

UniProt

Q14624

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ITIH4 Rabbit Polyclonal Antibody (orb333852) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002209

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QEVLWGSPAASDDGRRTLRVQGNDHSATRERRLDYQEGPPGVEISCWSVE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAB37 (NM_001006638) Human Over-expression Lysate
LC423534 20 µg

RAB37 (NM_001006638) Human Over-expression Lysate

Sign In for Pricing
View Details
TCL1 (T-Cell Marker) (TCL1/2747R), CF647 conjugate, 0.1mg/mL
BNC472747-500 1x 500 µL

TCL1 (T-Cell Marker) (TCL1/2747R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Vitamin K2 (MK-4)-4',5,6,7,8,8'-13C6
TRC-V895300-50MG 50 mg

Vitamin K2 (MK-4)-4',5,6,7,8,8'-13C6

Sign In for Pricing
View Details
Calcineurin A / PPP3CA (CALNA/2353), CF640R conjugate, 0.1mg/mL
BNC402353-500 1x 500 µL

Calcineurin A / PPP3CA (CALNA/2353), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Purinergic Receptor P2X, Ligand Gated Ion Channel 7 (P2RX7) ELISA Kit
RDR-P2RX7-Hu-01 96 Tests

Human Purinergic Receptor P2X, Ligand Gated Ion Channel 7 (P2RX7) ELISA Kit

Sign In for Pricing
View Details
Human Purinergic Receptor P2X, Ligand Gated Ion Channel 7 (P2RX7) ELISA Kit
RDR-P2RX7-Hu-02 48 Tests

Human Purinergic Receptor P2X, Ligand Gated Ion Channel 7 (P2RX7) ELISA Kit

Sign In for Pricing
View Details