Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LDB1 Peptide - C-terminal region

LDB1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

LDB1, CLIM2

UniProt

Q86U70

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LDB1 Rabbit Polyclonal Antibody (orb588131) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VAPPAEPTRQQPSKRRKRKMSGGSTMSSGGGNTNNSNSKKKSPASTFALS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OT antagonist 3 analog
HY-103652 1 Each

OT antagonist 3 analog

Sign In for Pricing
View Details
FOXD4L2 siRNA (h)
sc-92935 10 µM

FOXD4L2 siRNA (h)

Sign In for Pricing
View Details
STRN3 Antibody - C-terminal region
ARP73140_P050-25UL 25 µL

STRN3 Antibody - C-terminal region

Sign In for Pricing
View Details
DDEF1 (E-12) P
sc-374411 P 100 µg - 0.5 mL

DDEF1 (E-12) P

Sign In for Pricing
View Details
Zfp523 Protein Vector (Mouse) (pPB-N-His)
PV249663 500 ng

Zfp523 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
RNASE9 Rabbit Polyclonal Antibody (Biotin)
orb2114863 100 µL

RNASE9 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details