Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LDB1 Peptide - C-terminal region

LDB1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

LDB1, CLIM2

UniProt

Q86U70

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LDB1 Rabbit Polyclonal Antibody (orb588131) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VAPPAEPTRQQPSKRRKRKMSGGSTMSSGGGNTNNSNSKKKSPASTFALS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Blocks, Cecum
CB523118 1 Block

Frozen Tissue Blocks, Cecum

Sign In for Pricing
View Details
Lentiviral mouse Spef2 shRNA (UAS) - Lentiviral mouse Spef2 shRNA (UAS, iRFP) plasmid
GTR15249736 1 Vial

Lentiviral mouse Spef2 shRNA (UAS) - Lentiviral mouse Spef2 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
NOS3 CRISPRa sgRNA lentivector (set of three targets)(Human)
32010121 3x 1.0µg DNA

NOS3 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
TRBJ1-2 ORF Vector (Human) (pORF)
47595011 1.0 µg DNA

TRBJ1-2 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Lentiviral mouse Pld4 shRNA (UAS) - Lentiviral mouse Pld4 shRNA (UAS, iRFP) (100)
GTR15227439 1 Vial

Lentiviral mouse Pld4 shRNA (UAS) - Lentiviral mouse Pld4 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
FAM83D sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0732808 1.0 µg DNA

FAM83D sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details