Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LITAF Peptide - N-terminal region

LITAF Peptide - N-terminal region

Product Specifications

Product Name Alternative

LITAF, PIG7, SIMPLE

UniProt

Q99732

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LITAF Rabbit Polyclonal Antibody (orb331449) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PSYEETVAVNSYYPTPPAPMPGPTTGLVTGPDGKGMNPPSYYTQPAPIPN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vom1r75 Recombinant Protein (Rat)
RP236675 100 µg

Vom1r75 Recombinant Protein (Rat)

Sign In for Pricing
View Details
Human sm Actinin- α2 (ACTα2) ELISA Kit
YP-W100485-01 48 Tests

Human sm Actinin- α2 (ACTα2) ELISA Kit

Sign In for Pricing
View Details
Human sm Actinin- α2 (ACTα2) ELISA Kit
YP-W100485-02 96 Tests

Human sm Actinin- α2 (ACTα2) ELISA Kit

Sign In for Pricing
View Details
FGD5 Protein Vector (Human) (pPB-C-His)
PV016113 500 ng

FGD5 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Myeloid differentiation primary response protein MyD88 (MYD88) Rat ELISA Kit
F1670 96 Tests

Myeloid differentiation primary response protein MyD88 (MYD88) Rat ELISA Kit

Sign In for Pricing
View Details
Recombinant Pyrococcus abyssi Trk system potassium uptake protein trkA homolog (trkA)
MBS1413208-01 0.02 mg (E-Coli)

Recombinant Pyrococcus abyssi Trk system potassium uptake protein trkA homolog (trkA)

Sign In for Pricing
View Details