Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LITAF Peptide - N-terminal region

LITAF Peptide - N-terminal region

Product Specifications

Product Name Alternative

LITAF, PIG7, SIMPLE

UniProt

Q99732

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LITAF Rabbit Polyclonal Antibody (orb331449) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PSYEETVAVNSYYPTPPAPMPGPTTGLVTGPDGKGMNPPSYYTQPAPIPN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Oncomodulin, OCM ELISA KIT
E2186Ra-01 48 Well

Rat Oncomodulin, OCM ELISA KIT

Sign In for Pricing
View Details
Rat Oncomodulin, OCM ELISA KIT
E2186Ra-02 96 Well

Rat Oncomodulin, OCM ELISA KIT

Sign In for Pricing
View Details
Rat Oncomodulin, OCM ELISA KIT
E2186Ra-03 5x 96 Tests

Rat Oncomodulin, OCM ELISA KIT

Sign In for Pricing
View Details
Rat Oncomodulin, OCM ELISA KIT
E2186Ra-04 10x 96 Tests

Rat Oncomodulin, OCM ELISA KIT

Sign In for Pricing
View Details
PAWR Rabbit pAb, IRDye 800CW conjugated
orb2843383 100 µL

PAWR Rabbit pAb, IRDye 800CW conjugated

Sign In for Pricing
View Details
Goat anti-Guinea Pig IgG Heavy and Light Chain Cross-Adsorbed Antibody Biotinylated
MBS3906194-01 0.5 mg

Goat anti-Guinea Pig IgG Heavy and Light Chain Cross-Adsorbed Antibody Biotinylated

Sign In for Pricing
View Details