MEF2C Peptide - middle region
MEF2C Peptide - middle region
Product Specifications
Product Name Alternative
MEF2C
UniProt
Q06413
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MEF2C Rabbit Polyclonal Antibody (orb588138) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LMGGDLTSGAGTSAGNGYGNPRNSPGLLVSPGNLNKNMQAKSPPPMNLGM
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LV810374 1.0 µg DNA
TTC15 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
Sign In for Pricing
View Details 
orb2553122 100 µL
Phospho-HDAC5 (Ser259) Rabbit Polyclonal Antibody (BF680)
Sign In for Pricing
View Details 
GTR15229787 1 Vial
Lentiviral mouse Mphosph8 shRNA (UAS) - Lentiviral mouse Mphosph8 shRNA (UAS, RFP) (25)
Sign In for Pricing
View Details