MEF2C Peptide - middle region
MEF2C Peptide - middle region
Product Specifications
Product Name Alternative
MEF2C
UniProt
Q06413
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MEF2C Rabbit Polyclonal Antibody (orb588138) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LMGGDLTSGAGTSAGNGYGNPRNSPGLLVSPGNLNKNMQAKSPPPMNLGM
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
P20441W 1 Unit/Pack
Double Jumbo Test Tube Rack, RPP, 10-13 mm, 432 Places, White - ABDOS
Sign In for Pricing
View Details 