Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MPP1 Peptide - C-terminal region

MPP1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MRG1, PEMP, AAG12, EMP55, DXS552E

UniProt

Q00013

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MPP1 Rabbit Polyclonal Antibody (orb327246) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002427

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PVPYTTRPPRKSEEDGKEYHFISTEEMTRNISANEFLEFGSYQGNMFGTK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD352 Recombinant Protein
E43CP0302 500 µg

CD352 Recombinant Protein

Sign In for Pricing
View Details
Mrgprh Protein Vector (Mouse) (pPM-C-HA)
PV201932 500 ng

Mrgprh Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
DDX19B Human qPCR Primer Pair (NM_007242)
HP227653 200 Reactions

DDX19B Human qPCR Primer Pair (NM_007242)

Sign In for Pricing
View Details
MAGOH Protein Vector (Rat) (pPM-C-HA)
PV280804 500 ng

MAGOH Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
ING3 Protein Lysate
OCOA09357-20UG 20 µg

ING3 Protein Lysate

Sign In for Pricing
View Details
hsa-miR-4773 miRNA Inhibitor
MBS8294461-01 10 nmol

hsa-miR-4773 miRNA Inhibitor

Sign In for Pricing
View Details