Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MPP1 Peptide - C-terminal region

MPP1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MRG1, PEMP, AAG12, EMP55, DXS552E

UniProt

Q00013

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MPP1 Rabbit Polyclonal Antibody (orb327246) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002427

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PVPYTTRPPRKSEEDGKEYHFISTEEMTRNISANEFLEFGSYQGNMFGTK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse IL-12(p40) PicoKine ELISA Kit
MBS176558-01 96 Well

Mouse IL-12(p40) PicoKine ELISA Kit

Sign In for Pricing
View Details
Mouse IL-12(p40) PicoKine ELISA Kit
MBS176558-02 5x 96 Well

Mouse IL-12(p40) PicoKine ELISA Kit

Sign In for Pricing
View Details
CCBL1 Protein Vector (Human) (pPM-C-HA)
15160022 500 ng

CCBL1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
IGLP2 sgRNA CRISPR Lentivector (Human) (Target 2)
K1063403 1.0 µg DNA

IGLP2 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Cks1 HDR Plasmid (h)
sc-403019-HDR 20 µg

Cks1 HDR Plasmid (h)

Sign In for Pricing
View Details
Selenop Mouse shRNA Lentiviral Particle (Locus ID 20363)
TL517628V 500 µL Each

Selenop Mouse shRNA Lentiviral Particle (Locus ID 20363)

Sign In for Pricing
View Details