Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MTRR Peptide - middle region

MTRR Peptide - middle region

Product Specifications

Product Name Alternative

MTRR

UniProt

Q9UBK8

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MTRR Rabbit Polyclonal Antibody (orb327247) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LQPNIHASHEDSGKALAPKISISPRTTNSFHLPDDPSIPIIMVGPGTGIA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal ZBTB40 Antibody [FITC]
NBP1-06564F 0.1 mL

Rabbit Polyclonal ZBTB40 Antibody [FITC]

Sign In for Pricing
View Details
AMIGO1 (C-10)
sc-374419 200 µg/mL

AMIGO1 (C-10)

Sign In for Pricing
View Details
LONRF2 antibody
MBS5301930-01 0.1 mL

LONRF2 antibody

Sign In for Pricing
View Details
LONRF2 antibody
MBS5301930-02 5x 0.1 mL

LONRF2 antibody

Sign In for Pricing
View Details
AxyPrep Mag Plasmid Kit- Medium
AXY1036 1 Each

AxyPrep Mag Plasmid Kit- Medium

Sign In for Pricing
View Details
Recombinant Human XRCC2 Protein, N-His
E55P7589 50 µg

Recombinant Human XRCC2 Protein, N-His

Sign In for Pricing
View Details