Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MTRR Peptide - middle region

MTRR Peptide - middle region

Product Specifications

Product Name Alternative

MTRR

UniProt

Q9UBK8

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MTRR Rabbit Polyclonal Antibody (orb327247) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LQPNIHASHEDSGKALAPKISISPRTTNSFHLPDDPSIPIIMVGPGTGIA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Transcription factor HES 1 (HES1) ELISA kit
GTR10476663 96 Well

Rabbit Transcription factor HES 1 (HES1) ELISA kit

Sign In for Pricing
View Details
TSLP protein
30R-2752 20 ug

TSLP protein

Sign In for Pricing
View Details
Anti-SEL1L3 Antibody, Rabbit Polyclonal
MBS8109031-01 0.1 mL

Anti-SEL1L3 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-SEL1L3 Antibody, Rabbit Polyclonal
MBS8109031-02 5x 0.1 mL

Anti-SEL1L3 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
GIMAP6 Polyclonal Antibody, Cy5 Conjugated
bs-8272R-Cy5 100 µL

GIMAP6 Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
ACTB (Actin, beta, PS1TP5BP1) (PE)
MBS6186000-01 0.1 mL

ACTB (Actin, beta, PS1TP5BP1) (PE)

Sign In for Pricing
View Details