Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HNMT Peptide - C-terminal region

HNMT Peptide - C-terminal region

Product Specifications

Product Name Alternative

HNMT

UniProt

P50135

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HNMT Rabbit Polyclonal Antibody (orb588276) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_008826

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SGWDKLWKKYGSRFPQDDLCQYITSDDLTQMLDNLGLKYECYDLLSTMDI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PARP2 Mouse Monoclonal Antibody [Clone ID: AT29G4]
AM50055PU-S 50 µL

PARP2 Mouse Monoclonal Antibody [Clone ID: AT29G4]

Sign In for Pricing
View Details
CLEC18B (NM_001011880) Human Over-expression Lysate
LY423308 100 µg

CLEC18B (NM_001011880) Human Over-expression Lysate

Sign In for Pricing
View Details
Human CCDC85B activation kit by CRISPRa
GA107558 1 Kit

Human CCDC85B activation kit by CRISPRa

Sign In for Pricing
View Details
Human KIRREL1 activation kit by CRISPRa
GA110636 1 Kit

Human KIRREL1 activation kit by CRISPRa

Sign In for Pricing
View Details
4-Chloro-N-formylbenzamide
TRC-R234590-250MG 250 mg

4-Chloro-N-formylbenzamide

Sign In for Pricing
View Details
Frozen Tissue Sections, Skin
CS624738 5x 5 µm

Frozen Tissue Sections, Skin

Sign In for Pricing
View Details