Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HNMT Peptide - C-terminal region

HNMT Peptide - C-terminal region

Product Specifications

Product Name Alternative

HNMT

UniProt

P50135

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HNMT Rabbit Polyclonal Antibody (orb588276) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_008826

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SGWDKLWKKYGSRFPQDDLCQYITSDDLTQMLDNLGLKYECYDLLSTMDI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Alanine Aminopeptidase (AAP) ELISA Kit
RD-AAP-Hu-01 96 Tests

Human Alanine Aminopeptidase (AAP) ELISA Kit

Sign In for Pricing
View Details
Human Alanine Aminopeptidase (AAP) ELISA Kit
RD-AAP-Hu-02 48 Tests

Human Alanine Aminopeptidase (AAP) ELISA Kit

Sign In for Pricing
View Details
CHML Antibody
KC-23575-01 50 μL

CHML Antibody

Sign In for Pricing
View Details
CHML Antibody
KC-23575-02 100 µL

CHML Antibody

Sign In for Pricing
View Details
CHML Antibody
KC-23575-03 1 mL

CHML Antibody

Sign In for Pricing
View Details
TRAIL Recombinant Rabbit monoclonal Antibody
HA723634 100 µL

TRAIL Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details