Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HPSE2 Peptide - N-terminal region

HPSE2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

HPSE2, HPA2

UniProt

Q8WWQ2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HPSE2 Rabbit Polyclonal Antibody (orb588279) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LVTLARGLSPAFLRFGGKRTDFLQFQNLRNPAKSRGGPGPDYYLKNYEDD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prostaglandin E2 Receptor EP3 Subtype (PTGER3) Antibody (FITC)
abx317163-01 20 µg

Prostaglandin E2 Receptor EP3 Subtype (PTGER3) Antibody (FITC)

Sign In for Pricing
View Details
Prostaglandin E2 Receptor EP3 Subtype (PTGER3) Antibody (FITC)
abx317163-02 50 µg

Prostaglandin E2 Receptor EP3 Subtype (PTGER3) Antibody (FITC)

Sign In for Pricing
View Details
Prostaglandin E2 Receptor EP3 Subtype (PTGER3) Antibody (FITC)
abx317163-03 100 µg

Prostaglandin E2 Receptor EP3 Subtype (PTGER3) Antibody (FITC)

Sign In for Pricing
View Details
Prostaglandin E2 Receptor EP3 Subtype (PTGER3) Antibody (FITC)
abx317163-04 200 µg

Prostaglandin E2 Receptor EP3 Subtype (PTGER3) Antibody (FITC)

Sign In for Pricing
View Details
Prostaglandin E2 Receptor EP3 Subtype (PTGER3) Antibody (FITC)
abx317163-05 1 mg

Prostaglandin E2 Receptor EP3 Subtype (PTGER3) Antibody (FITC)

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O127:H6 (strain E2348/69/EPEC) KDPC Polyclonal Antibody
MBS7175927 Inquire

Rabbit anti-Escherichia coli O127:H6 (strain E2348/69/EPEC) KDPC Polyclonal Antibody

Sign In for Pricing
View Details