Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSD17B12 Peptide - C-terminal region

HSD17B12 Peptide - C-terminal region

Product Specifications

Product Name Alternative

KAR, SDR12C1

UniProt

Q53GQ0

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HSD17B12 Rabbit Polyclonal Antibody (orb327301) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057226

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KTVGLQSRTNGYLIHALMGSIISNLPSWIYLKIVMNMNKSTRAHYLKKTK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human RAB27A protein (His tag)
PDEH101004-01 20 µg

Recombinant Human RAB27A protein (His tag)

Sign In for Pricing
View Details
Recombinant Human RAB27A protein (His tag)
PDEH101004-02 100 µg

Recombinant Human RAB27A protein (His tag)

Sign In for Pricing
View Details
Recombinant Human RAB27A protein (His tag)
PDEH101004-03 500 µg

Recombinant Human RAB27A protein (His tag)

Sign In for Pricing
View Details
Recombinant Human RAB27A protein (His tag)
PDEH101004-04 1 mg

Recombinant Human RAB27A protein (His tag)

Sign In for Pricing
View Details
PRDM1 Human Gene Knockout Kit (CRISPR)
KN217363LP 1 Kit

PRDM1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Metonitazene
TRC-M257635-1MG 1 mg

Metonitazene

Sign In for Pricing
View Details