Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSD17B12 Peptide - C-terminal region

HSD17B12 Peptide - C-terminal region

Product Specifications

Product Name Alternative

KAR, SDR12C1

UniProt

Q53GQ0

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HSD17B12 Rabbit Polyclonal Antibody (orb327301) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057226

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KTVGLQSRTNGYLIHALMGSIISNLPSWIYLKIVMNMNKSTRAHYLKKTK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STAT6 Rabbit Polyclonal Antibody
AP02591PU-N 100 µL

STAT6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Myelin Basic Protein (MBP) (NM_001025092) Human Recombinant Protein
TP310291L 1 mg

Myelin Basic Protein (MBP) (NM_001025092) Human Recombinant Protein

Sign In for Pricing
View Details
P21 / WAF1 (CIP1/823 + DCS-60.2), CF647 conjugate, 0.1mg/mL
BNC471135-500 1x 500 µL

P21 / WAF1 (CIP1/823 + DCS-60.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GCM1 Mouse Monoclonal Antibody [Clone ID: OTI1A4]
CF810523 100 µg

GCM1 Mouse Monoclonal Antibody [Clone ID: OTI1A4]

Sign In for Pricing
View Details
CD36 Human Recombinant Protein, Synthetic Nanodisc
TP721416M 100 µg

CD36 Human Recombinant Protein, Synthetic Nanodisc

Sign In for Pricing
View Details
SH3RF1 Antibody
OC-006-01 50 μL

SH3RF1 Antibody

Sign In for Pricing
View Details