Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMP7 Peptide - C-terminal region

MMP7 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MMP7, MPSL1, PUMP1

UniProt

P09237

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MMP7 Rabbit Polyclonal Antibody (orb588302) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002414

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: THELGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKGIQKLYGKRS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Conivaptan Hydrochloride
MBS6050760-01 25 mg

Conivaptan Hydrochloride

Sign In for Pricing
View Details
Conivaptan Hydrochloride
MBS6050760-02 5x 25 mg

Conivaptan Hydrochloride

Sign In for Pricing
View Details
ZNF385A AAV Vector (Human) (CMV)
51486101 1 µg

ZNF385A AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Rabbit NLRP3 (NLR Family, Pyrin Domain Containing Protein 3) ELISA Kit
MBS8820059-01 48 Well

Rabbit NLRP3 (NLR Family, Pyrin Domain Containing Protein 3) ELISA Kit

Sign In for Pricing
View Details
Rabbit NLRP3 (NLR Family, Pyrin Domain Containing Protein 3) ELISA Kit
MBS8820059-02 96 Well

Rabbit NLRP3 (NLR Family, Pyrin Domain Containing Protein 3) ELISA Kit

Sign In for Pricing
View Details
Rabbit NLRP3 (NLR Family, Pyrin Domain Containing Protein 3) ELISA Kit
MBS8820059-03 5x 96 Well

Rabbit NLRP3 (NLR Family, Pyrin Domain Containing Protein 3) ELISA Kit

Sign In for Pricing
View Details