Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZIC4 Peptide - C-terminal region

ZIC4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ZIC4

UniProt

Q8N9L1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZIC4 Rabbit Polyclonal Antibody (orb573569) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115529

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VHTSDKPYTCKVRGCDKCYTHPSSLRKHMKVHGRSPPPSSGYDSATPSAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSPA8 Antibody
KC-4234-01 50 μL

HSPA8 Antibody

Sign In for Pricing
View Details
HSPA8 Antibody
KC-4234-02 100 µL

HSPA8 Antibody

Sign In for Pricing
View Details
HSPA8 Antibody
KC-4234-03 1 mL

HSPA8 Antibody

Sign In for Pricing
View Details
STAT6 Rabbit Polyclonal Antibody
ER40121 100 µL

STAT6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CF®594 Monoclonal Mouse Anti-Fluorescein (FITC) IgG, 2 mg/mL
#20211 1x 250 µL

CF®594 Monoclonal Mouse Anti-Fluorescein (FITC) IgG, 2 mg/mL

Sign In for Pricing
View Details
Aspartate Aminotransferase (GOT1) Human Knockdown Lysate
LY300347 100 µg

Aspartate Aminotransferase (GOT1) Human Knockdown Lysate

Sign In for Pricing
View Details